Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectsmeadowtropical
Anethum graveolens or Dill from Herb
Larkspur Flower from Larkspur
Hemerocallis Spp or Day Lily from Perennial
Caterpillar and Buttefly from Caterpillar
Orchids from Orchid
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Common Buttercup Flower from Buttercup
Rhododendron Calendulaceum or Flame Azalea from Azalea
Flower Poppy from Red
Europeana Floribunda Rose from Roses
Butterfly from Cartoon animals viii coloring book
Steampunk Bee from Steampunk animals coloring book
Cosmos Scabiosoides from Cosmos
Daffodil from Daffodil
Apple Blossom Branch from Apple tree
Bee from Cartoon animals v coloring book
Bumblebee from Woodland animals
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Swallow Tail Hummingbird from Hummingbirds
Pollinators of Alaska from Nps
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Iris Motif from Iris
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Orchid Lycaste Aromatica from Orchid
Disa Kewensis Orchid from Orchid
Iris Flower Blossom from Iris
Black Elderberry from Elderberry
Chrysanthemum 1 from Perennial
Double Delight Hybrid Tea Rose from Roses
Bee from Cartoon animals viii coloring book
Black Raspberry from Celebrating wildflowers coloring book
Heliconia Indica from Heliconia
Spring Crocus from Crocus
Butterfly from Cartoon animals vii coloring book
Chinese Peony from Flowers
Common Fruit Bats from Realistic animals coloring book
Bug from Animals
Cherokee Rose from Roses
Hibiscus from Realistic flowers
Hibiscus Flower from Hawaii flower
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
Saskatoon from Serviceberry
Renanthera Imschootiana Orchid from Orchid
Masdevallia Coccinea Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Simple objects coloring book
Realistic Sunflowers from Sunflower
Ladybug from Cartoon animals viii coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Daisy from Simple objects iv coloring book
Ladybug from Cartoon animals v coloring book
Bumblebee from Bumblebee
Hummingbird from Cartoon animals ii coloring book
Cornflower, Blue Bottle from Cornflowers
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Bluebell Bellflower from Bellflower
Ranunculus Acris from Buttercup
Aster or Star Plant from Asters
Burke's Larkspur from Celebrating wildflowers coloring book
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Heliconia Psittacorum from Heliconia
Scarlet Carnation from Carnation
Butterfly Flies On A Flower from Flowers
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Schlumbergera Bloom from Cactus
Aquilegia Truncata Red Columbine from Columbine
Viola Adunca or Pale Mountain Violet from Violet
Cirsium Vulgare or Bull Thistle from Thistle
Daffodil Flowers from Daffodil
Oriental poppy from Perennial
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Clarkia Amoena Farewell to Spring from Godetia
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Bug from Cartoon animals coloring book
Wildflower from Plants ii coloring book
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Big-Headed Clover from Celebrating wildflowers coloring book
Black Locust from Locust tree
Yellow Edged Giant Owl Butterfly from Butterfly
Daffodil from Daffodil
Chrysanthemum Morifolium from Flower garden
Life Cycle of Monarch Butterfly from Biology
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Pink Hibiscus from Realistic flowers
Chrysanthemum Carinatum from Realistic flowers
Anemone Coronaria from Anemone
Blooming Sunflower from Sunflower
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper on Flower from Grasshoppers
Common Evening Primrose or Evening Star from Primrose
Aster 1 from Asters
Grasshopper in Garden from Grasshoppers
Cornflower from Cornflowers
Sundowner Rosa Grandiflora from Roses
Sophronitis Cernua Orchid from Orchid
201 - 300 of 1,830 Next page
/ 19